RegulonDB RegulonDB 10.8: Gene Form
   

yeaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcJ yeaK yoaI TSS_2123 TSS_2123

Gene      
Name: yeaK    Texpresso search in the literature
Synonym(s): ECK1785, G6973, b1787
Genome position(nucleotides): 1873574 --> 1874077 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ASAP:
ABE-0005945
ECHOBASE:
EB3270
OU-MICROARRAY:
b1787
PortEco:
yeaK
STRING:
511145.b1787
COLOMBOS: yeaK


Product      
Name: mischarged aminoacyl-tRNA deacylase
Synonym(s): ProXp-ST1, ProXp-y, YeaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.851
Isoelectric point: 7.044
Motif(s):
 
Type Positions Sequence
30 -> 154 HEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLKLVADPLLFERFDEIAFNAGMLDKSVILKTADYLR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0002161 - aminoacyl-tRNA editing activity
GO:0002196 - Ser-tRNA(Ala) hydrolase activity
biological_process GO:0106074 - aminoacyl-tRNA metabolism involved in translational fidelity
GO:0045903 - positive regulation of translational fidelity
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Liu Z., et al., 2015
[2] Vargas-Rodriguez O., et al., 2013
External database links:  
DIP:
DIP-48168N
ECOCYC:
G6973-MONOMER
ECOLIWIKI:
b1787
INTERPRO:
IPR007214
INTERPRO:
IPR036754
MODBASE:
P64483
PFAM:
PF04073
PRIDE:
P64483
REFSEQ:
NP_416301
SMR:
P64483
UNIPROT:
P64483


Operon      
Name: yeaK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2123 1873544 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Liu Z., Vargas-Rodriguez O., Goto Y., Novoa EM., Ribas de Pouplana L., Suga H., Musier-Forsyth K., 2015, Homologous trans-editing factors with broad tRNA specificity prevent mistranslation caused by serine/threonine misactivation., Proc Natl Acad Sci U S A 112(19):6027-32

 [2] Vargas-Rodriguez O., Musier-Forsyth K., 2013, Exclusive use of trans-editing domains prevents proline mistranslation., J Biol Chem 288(20):14391-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB