RegulonDB RegulonDB 10.8: Gene Form
   

yeaO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nimT yeaO yoaF terminator anti-terminator anti-anti-terminator TSS_2124 TSS_2124 yeaOp3 yeaOp3 yeaOp4 yeaOp4

Gene      
Name: yeaO    Texpresso search in the literature
Synonym(s): ECK1790, G6978, b1792
Genome position(nucleotides): 1876909 --> 1877256 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.59
External database links:  
ASAP:
ABE-0005964
ECHOBASE:
EB3274
OU-MICROARRAY:
b1792
PortEco:
yeaO
STRING:
511145.b1792
COLOMBOS: yeaO


Product      
Name: DUF488 domain-containing protein YeaO
Synonym(s): YeaO
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.386
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
5 -> 112 CKRVYDPAEQSDGYRILVDRLWPRGIKKTDLALDEWDKEITPSTELRKAFHGEVVDYATFREQYLAELAQHEQEGKRLADIAKKQPLTLLYSAKNTTQNHALVLADWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11794N
ECOCYC:
G6978-MONOMER
ECOLIWIKI:
b1792
INTERPRO:
IPR007438
PFAM:
PF04343
PRIDE:
P76243
REFSEQ:
NP_416306
UNIPROT:
P76243


Operon      
Name: yeaO         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaOp4 1876777 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaOp3 1876822 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2124 1876877 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB