RegulonDB RegulonDB 10.8: Gene Form
   

dgcP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcP yoaF yoaK TSS_2126 TSS_2126 TSS_2125 TSS_2125 yoaFp10 yoaFp10 yeaPp3 yeaPp3 yeaPp yeaPp

Gene      
Name: dgcP    Texpresso search in the literature
Synonym(s): ECK1792, G6980, b1794, yeaP
Genome position(nucleotides): 1877715 --> 1878740 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.05
External database links:  
ASAP:
ABE-0005972
ECHOBASE:
EB3275
OU-MICROARRAY:
b1794
PortEco:
yeaP
STRING:
511145.b1794
COLOMBOS: dgcP


Product      
Name: diguanylate cyclase DgcP
Synonym(s): DgcP, YeaP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 38.546
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
204 -> 337 HKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLNTLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIRGEYHLGDVDLYYPGASLGIVEVDPETTDADSALHAADIAMYQEKKHKQKTPFVAHP
17 -> 155 QSLESLVRQLLEMLEMVTDMESTYLTKVDVEARLQHIMFARNSQKMYIPENFTVSWDYSLCKRAIDENCFFSDEVPDRWGDCIAARNLGITTFLSTPIHLPDGSFYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYIQ
175 -> 330 YTDSLTGLPNRRAIFENLTTLFSLARHLNHKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLNTLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIRGEYHLGDVDLYYPGASLGIVEVDPETTDADSALHAADIAMYQEKKHKQK
18 -> 154 SLESLVRQLLEMLEMVTDMESTYLTKVDVEARLQHIMFARNSQKMYIPENFTVSWDYSLCKRAIDENCFFSDEVPDRWGDCIAARNLGITTFLSTPIHLPDGSFYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11795N
ECOCYC:
G6980-MONOMER
ECOLIWIKI:
b1794
INTERPRO:
IPR003018
INTERPRO:
IPR000160
INTERPRO:
IPR029787
INTERPRO:
IPR029016
MINT:
MINT-1321161
MODBASE:
P76245
PFAM:
PF13185
PFAM:
PF00990
PRIDE:
P76245
PROSITE:
PS50887
REFSEQ:
NP_416308
SMART:
SM00267
SMART:
SM00065
SMR:
P76245
UNIPROT:
P76245


Operon      
Name: dgcP         
Operon arrangement:
Transcription unit        Promoter
yeaP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaPp3 1877666 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yoaFp10 1877722 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2125 1878552 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2126 1878589 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB