RegulonDB RegulonDB 10.8: Gene Form
   

yeaQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaQ yoaG yoaJ yeaQp1 yeaQp1 yeaQp3 yeaQp3 TSS_2127 TSS_2127

Gene      
Name: yeaQ    Texpresso search in the literature
Synonym(s): ECK1793, G6981, b1795
Genome position(nucleotides): 1879007 <-- 1879255 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.18
External database links:  
ASAP:
ABE-0005974
ECHOBASE:
EB3276
OU-MICROARRAY:
b1795
PortEco:
yeaQ
STRING:
511145.b1795
COLOMBOS: yeaQ


Product      
Name: PF04226 family protein YeaQ
Synonym(s): YeaQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.671
Isoelectric point: 10.687
Motif(s):
 
Type Positions Sequence
33 -> 81 ILLGIVGAVVGGWISTLFGFGKVDGFNFGSFVVAVIGAIVVLFIYRKIK
26 -> 46 GGGFFMTILLGIVGAVVGGWI
57 -> 77 GFNFGSFVVAVIGAIVVLFIY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6981-MONOMER
ECOLIWIKI:
b1795
INTERPRO:
IPR007341
PANTHER:
PTHR33884
PFAM:
PF04226
PRIDE:
P64485
REFSEQ:
NP_416309
UNIPROT:
P64485


Operon      
Name: yeaQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2127 1879297 reverse nd [RS-EPT-CBR] [1]
  promoter yeaQp3 1879360 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeaQp1 1879390 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB