RegulonDB RegulonDB 10.8: Gene Form
   

yeaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuE yeaR yoaG Fis NarP NarL NarP NarL Fis NsrR yeaRp yeaRp

Gene      
Name: yeaR    Texpresso search in the literature
Synonym(s): ECK1795, G6983, b1797
Genome position(nucleotides): 1879589 <-- 1879948 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.33
External database links:  
ASAP:
ABE-0005979
ECHOBASE:
EB3277
OU-MICROARRAY:
b1797
PortEco:
yeaR
STRING:
511145.b1797
COLOMBOS: yeaR


Product      
Name: DUF1971 domain-containing protein YeaR
Synonym(s): YeaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.611
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
12 -> 96 RSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6983-MONOMER
ECOLIWIKI:
b1797
INTERPRO:
IPR014510
INTERPRO:
IPR015392
INTERPRO:
IPR014710
PDB:
3BB6
PFAM:
PF09313
PRIDE:
P64488
REFSEQ:
NP_416311
SMR:
P64488
UNIPROT:
P64488


Operon      
Name: yeaR-yoaG         
Operon arrangement:
Transcription unit        Promoter
yeaR-yoaG


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, NarP
Repressed by: NsrR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB