RegulonDB RegulonDB 10.7: Gene Form
   

yeaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaV yeaW yeaX

Gene      
Name: yeaW    Texpresso search in the literature
Synonym(s): ECK1800, G6988, b1802
Genome position(nucleotides): 1884665 --> 1885789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0005997
ECHOBASE:
EB3282
OU-MICROARRAY:
b1802
PORTECO:
yeaW
REGULONDB:
b1802
STRING:
511145.b1802
M3D: yeaW
COLOMBOS: yeaW
PortEco: b1802


Product      
Name: carnitine monooxygenase subunit YeaW
Synonym(s): 2Fe-2S cluster-containing protein, YeaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.561
Isoelectric point: 5.537
Motif(s):
 
Type Positions Sequence
46 -> 134 SWICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDGNLAHARNCENVANF
47 -> 155 WICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDGNLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFI
184 -> 370 DLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQYGFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIYFTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHGIAHFHNLLAQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0042802 - identical protein binding
biological_process GO:0044237 - cellular metabolic process
GO:0009437 - carnitine metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6988-MONOMER
ECOLIWIKI:
b1802
INTERPRO:
IPR015881
INTERPRO:
IPR039004
INTERPRO:
IPR036922
INTERPRO:
IPR001663
INTERPRO:
IPR015879
INTERPRO:
IPR017941
MODBASE:
P0ABR7
PFAM:
PF00355
PFAM:
PF00848
PRIDE:
P0ABR7
PRINTS:
PR00090
PROSITE:
PS00570
PROSITE:
PS51296
PROTEINMODELPORTAL:
P0ABR7
REFSEQ:
NP_416316
SMR:
P0ABR7
UNIPROT:
P0ABR7


Operon      
Name: yeaVW         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB