RegulonDB RegulonDB 10.8: Gene Form
   

yeaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rnd yeaW yeaX

Gene      
Name: yeaX    Texpresso search in the literature
Synonym(s): ECK1801, G6989, b1803
Genome position(nucleotides): 1885845 --> 1886810 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.1
External database links:  
ASAP:
ABE-0006000
ECHOBASE:
EB3283
OU-MICROARRAY:
b1803
PortEco:
yeaX
STRING:
511145.b1803
COLOMBOS: yeaX


Product      
Name: carnitine monooxygenase subunit YeaX
Synonym(s): YeaX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.661
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
242 -> 312 SGKEFVVPEEMTILQVIENNKAAKVECLCREGVCGTCETAILEGEADHRDQYFSDEERASQQSMLICCSRA
4 -> 109 YQMFEVQVSQVEPLTEQVKRFTLVATDGKPLPAFTGGSHVIVQMSDGDNQYSNAYSLLSSPHDTSCYQIAVRLEENSRGGSRFLHQQVKVGDRLTISTPNNLFALI
117 -> 207 FIAGGIGITPFLSHMAELQHSDVDWQLHYCSRNPESCAFRDELVQHPQAEKVHLHHSSTGTRLELARLLADIEPGTHVYTCGPEALIEAVR
233 -> 321 DAFTLVLARSGKEFVVPEEMTILQVIENNKAAKVECLCREGVCGTCETAILEGEADHRDQYFSDEERASQQSMLICCSRAKGKRLVLDL
9 -> 103 VQVSQVEPLTEQVKRFTLVATDGKPLPAFTGGSHVIVQMSDGDNQYSNAYSLLSSPHDTSCYQIAVRLEENSRGGSRFLHQQVKVGDRLTISTPN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
biological_process GO:0009437 - carnitine metabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6989-MONOMER
ECOLIWIKI:
b1803
INTERPRO:
IPR017938
INTERPRO:
IPR039261
INTERPRO:
IPR039003
INTERPRO:
IPR036010
INTERPRO:
IPR017927
INTERPRO:
IPR012675
INTERPRO:
IPR008333
INTERPRO:
IPR006058
INTERPRO:
IPR001433
INTERPRO:
IPR001041
INTERPRO:
IPR000951
MODBASE:
P76254
PFAM:
PF00111
PFAM:
PF00175
PFAM:
PF00970
PRIDE:
P76254
PRINTS:
PR00409
PROSITE:
PS00197
PROSITE:
PS51384
PROSITE:
PS51085
REFSEQ:
NP_416317
SMR:
P76254
UNIPROT:
P76254


Operon      
Name: yeaX         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB