RegulonDB RegulonDB 10.8: Gene Form
   

yeaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadD tsaB yeaY sroD FadR CRP FadR ArcA ppGpp anti-anti-terminator anti-terminator yeaYp yeaYp fadDp fadDp rndp rndp

Gene      
Name: yeaY    Texpresso search in the literature
Synonym(s): ECK1804, G6990, b1806
Genome position(nucleotides): 1889951 <-- 1890532 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0006011
ECHOBASE:
EB3284
OU-MICROARRAY:
b1806
PortEco:
yeaY
STRING:
511145.b1806
COLOMBOS: yeaY


Product      
Name: Slp family lipoprotein YeaY
Synonym(s): YeaY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.921
Isoelectric point: 9.911
Motif(s):
 
Type Positions Sequence
1 -> 22 MAVQKNVIKGILAGTFALMLSG
124 -> 124 A
20 -> 167 LSGCVTVPDAIKGSSPTPQQDLVRVMSAPQLYVGQEARFGGKVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYADVNGFLDPVDFRGQLVTVVGPITGAVDGKIGNTPYKFMVMQVTGYKRWHLTQQVIMPPQPIDPWFYGG
23 -> 193 CVTVPDAIKGSSPTPQQDLVRVMSAPQLYVGQEARFGGKVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYADVNGFLDPVDFRGQLVTVVGPITGAVDGKIGNTPYKFMVMQVTGYKRWHLTQQVIMPPQPIDPWFYGGRGWPYGYGGWGWYNPGPARVQTVVTE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28087N
ECOCYC:
G6990-MONOMER
ECOLIWIKI:
b1806
INTERPRO:
IPR004658
PANTHER:
PTHR37530
PFAM:
PF03843
PRIDE:
P0AA91
PROSITE:
PS51257
REFSEQ:
NP_416320
UNIPROT:
P0AA91


Operon      
Name: tsaB-yeaY         
Operon arrangement:
Transcription unit        Promoter
yeaY
tsaB-yeaY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB