RegulonDB RegulonDB 10.8: Gene Form
   

tsaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yoaA tsaB yeaY terminator TSS_2130 (cluster) TSS_2130 (cluster) yeaYp yeaYp

Gene      
Name: tsaB    Texpresso search in the literature
Synonym(s): ECK1805, G6991, b1807, yeaZ
Genome position(nucleotides): 1890572 <-- 1891267 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.6
External database links:  
ASAP:
ABE-0006013
ECHOBASE:
EB3285
OU-MICROARRAY:
b1807
PortEco:
yeaZ
STRING:
511145.b1807
COLOMBOS: tsaB


Product      
Name: N6-L-threonylcarbamoyladenine synthase, TsaB subunit
Synonym(s): TsaB, YeaZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.181
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
28 -> 131 ELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008237 - metallopeptidase activity
GO:0042802 - identical protein binding
biological_process GO:0006508 - proteolysis
GO:0008033 - tRNA processing
GO:0002949 - tRNA threonylcarbamoyladenosine modification
Note(s): Note(s): ...[more].
Reference(s): [1] Mahnic M., et al., 2012
[2] Rajagopala SV., et al., 2010
External database links:  
DIP:
DIP-11804N
ECOCYC:
G6991-MONOMER
ECOLIWIKI:
b1807
INTERPRO:
IPR022496
INTERPRO:
IPR000905
MINT:
MINT-1255819
MODBASE:
P76256
PANTHER:
PTHR11735:SF11
PANTHER:
PTHR11735
PDB:
4WQ5
PDB:
4WQ4
PDB:
4YDU
PDB:
1OKJ
PFAM:
PF00814
PRIDE:
P76256
REFSEQ:
NP_416321
SMR:
P76256
SWISSMODEL:
P76256
UNIPROT:
P76256


Operon      
Name: tsaB-yeaY         
Operon arrangement:
Transcription unit        Promoter
yeaY
tsaB-yeaY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2130 (cluster) 1891297 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Mahnic M., Baebler S., Blejec A., Jalen S., Gruden K., Menart V., Jevsevar S., 2012, Gene Expression Profiling of Recombinant Protein Producing E. coli at Suboptimal Growth Temperature., Acta Chim Slov 59(1):59-69

 [2] Rajagopala SV., Yamamoto N., Zweifel AE., Nakamichi T., Huang HK., Mendez-Rios JD., Franca-Koh J., Boorgula MP., Fujita K., Suzuki K., Hu JC., Wanner BL., Mori H., Uetz P., 2010, The Escherichia coli K-12 ORFeome: a resource for comparative molecular microbiology., BMC Genomics 11:470

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB