RegulonDB RegulonDB 10.7: Gene Form
   

yoaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pabB yoaC yoaH TSS_2138 TSS_2138 TSS_2137 TSS_2137 yoaHp1 yoaHp1 pabBp6 pabBp6 TSS_2136 TSS_2136 pabBp7 pabBp7

Gene      
Name: yoaH    Texpresso search in the literature
Synonym(s): ECK1809, G6995, b1811
Genome position(nucleotides): 1894552 <-- 1894731 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.11
External database links:  
ASAP:
ABE-0006026
ECHOBASE:
EB4053
OU-MICROARRAY:
b1811
PORTECO:
yoaH
REGULONDB:
b1811
STRING:
511145.b1811
M3D: yoaH
COLOMBOS: yoaH
PortEco: b1811


Product      
Name: UFP0181 family protein YoaH
Synonym(s): YoaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.554
Isoelectric point: 4.329
Motif(s):
 
Type Positions Sequence
1 -> 49 MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGER

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6995-MONOMER
ECOLIWIKI:
b1811
INTERPRO:
IPR005371
PFAM:
PF03701
PRIDE:
P67338
PRODOM:
PD026807
PROTEINMODELPORTAL:
P67338
REFSEQ:
NP_416325
UNIPROT:
P67338


Operon      
Name: yoaH         
Operon arrangement:
Transcription unit        Promoter
yoaH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pabBp7 1894628 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2136 1894757 forward nd [RS-EPT-CBR] [2]
  promoter pabBp6 1894779 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yoaHp1 1894933 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2137 1896141 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2138 1896143 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB