RegulonDB RegulonDB 10.8: Gene Form
   

pdeD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeD yoaE sdaA yoaL

Gene      
Name: pdeD    Texpresso search in the literature
Synonym(s): ECK1813, G6996, b1815, yoaD
Genome position(nucleotides): 1898427 --> 1900025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.53
External database links:  
ASAP:
ABE-0006043
ECHOBASE:
EB3289
OU-MICROARRAY:
b1815
PortEco:
yoaD
STRING:
511145.b1815
COLOMBOS: pdeD


Product      
Name: putative c-di-GMP phosphodiesterase PdeD
Synonym(s): PdeD, YoaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol
Molecular weight: 59.711
Isoelectric point: 8.916
Motif(s):
 
Type Positions Sequence
16 -> 36 MIVCTICALVTLASTLSVRFI
43 -> 240 QQRVVQFANHAVEELDKVLLPLQAGSEVLLPLIGLPCSVAHLPLRKQAAKLQTVRSIGLVQDGTLYCSSIFGYRNVPVVDILAELPAPQPLLRLTIDRALIKGSPVLIQWTPAAGSSNAGVMEMINIDLLTAMLLEPQLPQISSASLTVDKRHLLYGNGLVDSLPQPEDNENYQVSSQRFPFTINVNGPGATALAWHY
266 -> 515 RMSFSREINLGLAQHEFELFCQPLLNARSQQCIGVEILLRWNNPRQGWISPDVFIPIAEEHHLIVPLTRYVMAETIRQRHVFPMSSQFHVGINVAPSHFRRGVLIKDLNQYWFSAHPIQQLILEITERDALLDVDYRIARELHRKNVKLAIDDFGTGNSSFSWLETLRPDVLKIDKSFTAAIGSDAVNSTVTDIIIALGQRLNIELVAEGVETQEQAKYLRRHGVHILQGYLYAQPMPLRDFPKWLAGSQ
245 -> 265 LPLAVLLSLLVGYIAWLATAY
17 -> 36 IVCTICALVTLASTLSVRFI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Sarenko O., et al., 2017
External database links:  
ECOCYC:
G6996-MONOMER
ECOLIWIKI:
b1815
INTERPRO:
IPR035919
INTERPRO:
IPR024744
INTERPRO:
IPR001633
PFAM:
PF00563
PFAM:
PF12792
PRIDE:
P76261
PROSITE:
PS50883
REFSEQ:
NP_416329
SMART:
SM00052
SMR:
P76261
UNIPROT:
P76261


Operon      
Name: pdeD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sarenko O., Klauck G., Wilke FM., Pfiffer V., Richter AM., Herbst S., Kaever V., Hengge R., 2017, More than Enzymes That Make or Break Cyclic Di-GMP-Local Signaling in the Interactome of GGDEF/EAL Domain Proteins of Escherichia coli., MBio 8(5)


RegulonDB