RegulonDB RegulonDB 10.8: Gene Form
   

yoaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeD yoaE manX yoaL Cra NagC Mlc CRP Mlc NagC CRP TSS_2146 TSS_2146 TSS_2145 TSS_2145 TSS_2144 TSS_2144 TSS_2143 TSS_2143 TSS_2142 (cluster) TSS_2142 (cluster) manXp manXp yoaEp yoaEp TSS_2140 TSS_2140

Gene      
Name: yoaE    Texpresso search in the literature
Synonym(s): ECK1814, G6997, b1816, borG
Genome position(nucleotides): 1900029 <-- 1901585 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0006045
ECHOBASE:
EB3290
OU-MICROARRAY:
b1816
PortEco:
yoaE
STRING:
511145.b1816
COLOMBOS: yoaE


Product      
Name: putative inner membrane protein
Synonym(s): BorG, YoaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.528
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
14 -> 203 LTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLLGLSLALIMRLGLLSLISWMVTLTKPLFTVMDFSFSGRDLIMLFGGIFLLFKATTELHERLENRDHDSGHGKGYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVNQHPTVVVLCLSFLLMIGLSLVAE
434 -> 509 DGDGWLVKGGTDLHALQQALDVEHLADDDDIATVAGLVISANGHIPRVGDVIDVGPLHITIIEANDYRVDLVRIVK
125 -> 145 FWVVVTQIVILDAVFSLDAVI
304 -> 363 MTPRGEISWVDANLGVDEIREQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEGVDV
367 -> 427 ASASPAIIVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAGEFPDADE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0050660 - flavin adenine dinucleotide binding
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
G6997-MONOMER
ECOLIWIKI:
b1816
INTERPRO:
IPR000644
INTERPRO:
IPR036318
INTERPRO:
IPR016169
INTERPRO:
IPR005496
INTERPRO:
IPR005170
MODBASE:
P0AEC0
PFAM:
PF03471
PFAM:
PF03741
PRIDE:
P0AEC0
PROSITE:
PS51371
REFSEQ:
NP_416330
SMART:
SM01091
SMR:
P0AEC0
UNIPROT:
P0AEC0


Operon      
Name: yoaE         
Operon arrangement:
Transcription unit        Promoter
yoaE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2140 1901769 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2142 (cluster) 1901934 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2143 1902030 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2144 1902032 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2145 1902072 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2146 1902618 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB