RegulonDB RegulonDB 10.8: Gene Form
   

yobD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

manZ mntP yobD rlmA Fur MntR MntR terminator anti-terminator anti-anti-terminator terminator TSS_2172 TSS_2172 mntPp mntPp TSS_2171 TSS_2171 TSS_2170 TSS_2170 TSS_2169 TSS_2169

Gene      
Name: yobD    Texpresso search in the literature
Synonym(s): ECK1818, G6998, b1820
Genome position(nucleotides): 1904801 --> 1905259 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.1
External database links:  
ASAP:
ABE-0006062
ECHOBASE:
EB3706
OU-MICROARRAY:
b1820
PortEco:
yobD
STRING:
511145.b1820
COLOMBOS: yobD


Product      
Name: DUF986 domain-containing inner membrane protein YobD
Synonym(s): YobD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.615
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
45 -> 65 IDSVIFVGLIVILIYNNVTNH
67 -> 87 ALITTWLLSALALMGFYIFWI
4 -> 150 TDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYNNVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDGVLVMQLEQRRLLIRVRNIDDLEKIYKLLVS
6 -> 26 LVLILFIAALLAFAIYDQFIM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6998-MONOMER
ECOLIWIKI:
b1820
INTERPRO:
IPR009328
PFAM:
PF06173
PRIDE:
P67601
PRODOM:
PD091196
REFSEQ:
NP_416334
SMR:
P67601
UNIPROT:
P67601


Operon      
Name: yobD         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2169 1903946 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2170 1903975 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2171 1904505 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2172 1905462 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB