RegulonDB RegulonDB 10.7: Gene Form
   

kdgR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebQ kdgR yobH kdgRp1 kdgRp1 yebQp5 yebQp5 yebQp4 yebQp4 kdgRp9 kdgRp9 kdgRp8 kdgRp8

Gene      
Name: kdgR    Texpresso search in the literature
Synonym(s): ECK1826, G7003, b1827, yebP
Genome position(nucleotides): 1909308 <-- 1910099 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.75
External database links:  
ASAP:
ABE-0006081
ECHOBASE:
EB3772
OU-MICROARRAY:
b1827
PORTECO:
kdgR
REGULONDB:
b1827
STRING:
511145.b1827
M3D: kdgR
COLOMBOS: kdgR
PortEco: b1827


Product      
Name: DNA-binding transcriptional repressor KdgR
Synonym(s): KdgR, YebP
Sequence: Get amino acid sequence Fasta Format
Regulator Family: IclR
Cellular location: cytosol
Molecular weight: 30.029
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
34 -> 53 ITELSQRVMMSKSTVYRFLQ
89 -> 258 LIRSADIQMRELSRLTKETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLYSTAIGKVLLAWRDRDEVKQILEGVEYKRSTERTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTLRFSEERLQEYVAMLHTAARKISAQMGY
15 -> 65 SVLKVFGILQALGEEREIGITELSQRVMMSKSTVYRFLQTMKTLGYVAQEG
13 -> 74 VSSVLKVFGILQALGEEREIGITELSQRVMMSKSTVYRFLQTMKTLGYVAQEGESEKYSLTL
129 -> 254 NLRMYSRIGRRNPLYSTAIGKVLLAWRDRDEVKQILEGVEYKRSTERTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTLRFSEERLQEYVAMLHTAARKISA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Murray EL., et al., 2005
[2] Nishino K., et al., 2001
[3] Pouyssegur J., et al., 1974
External database links:  
DIP:
DIP-10057N
ECOCYC:
G7003-MONOMER
ECOLIWIKI:
b1827
INTERPRO:
IPR014757
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR029016
INTERPRO:
IPR005471
INTERPRO:
IPR011991
MODBASE:
P76268
PDB:
1YSP
PFAM:
PF01614
PFAM:
PF09339
PRIDE:
P76268
PRODB:
PRO_000023048
PROSITE:
PS51077
PROSITE:
PS51078
PROTEINMODELPORTAL:
P76268
REFSEQ:
NP_416341
SMART:
SM00346
SMR:
P76268
UNIPROT:
P76268


Operon      
Name: kdgR         
Operon arrangement:
Transcription unit        Promoter
kdgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter kdgRp8 1910125 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter kdgRp9 1910140 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yebQp4 1910157 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yebQp5 1910159 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter kdgRp1 1910253 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Murray EL., Conway T., 2005, Multiple regulators control expression of the Entner-Doudoroff aldolase (Eda) of Escherichia coli., J Bacteriol 187(3):991-1000

 [2] Nishino K., Yamaguchi A., 2001, Analysis of a complete library of putative drug transporter genes in Escherichia coli., J Bacteriol 183(20):5803-12

 [3] Pouyssegur J., Stoeber F., 1974, Genetic control of the 2-keto-3-deoxy-d-gluconate metabolism in Escherichia coli K-12: kdg regulon., J Bacteriol 117(2):641-51

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB