RegulonDB RegulonDB 10.8: Gene Form
   

yebV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsmF yebV yebW RyeB yebWp6 yebWp6 yebWp3 yebWp3 yebVp5 yebVp5 yebVp1 yebVp1 yebVp6 yebVp6 yebVp2 yebVp2

Gene      
Name: yebV    Texpresso search in the literature
Synonym(s): ECK1835, G7009, b1836
Genome position(nucleotides): 1921780 --> 1922016 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.52
External database links:  
ASAP:
ABE-0006110
ECHOBASE:
EB3778
OU-MICROARRAY:
b1836
PortEco:
yebV
STRING:
511145.b1836
COLOMBOS: yebV


Product      
Name: DUF1480 domain-containing protein YebV
Synonym(s): YebV
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.753
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
2 -> 77 KTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSVLYRTRYDQQSDAWIMRL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48173N
ECOCYC:
G7009-MONOMER
ECOLIWIKI:
b1836
INTERPRO:
IPR009950
PFAM:
PF07351
PRIDE:
P64503
PRODOM:
PD060427
REFSEQ:
NP_416350
UNIPROT:
P64503


Operon      
Name: yebV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebVp2 1921715 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebVp6 1921725 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebVp1 1921745 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebVp5 1921753 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebWp3 1921957 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebWp6 1922084 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB