RegulonDB RegulonDB 10.8: Gene Form
   

yebZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebZ yobA yebY FnrS anti-anti-terminator anti-terminator pphAp pphAp

Gene      
Name: yebZ    Texpresso search in the literature
Synonym(s): ECK1841, G7013, b1840
Genome position(nucleotides): 1923719 <-- 1924591 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.15
External database links:  
ASAP:
ABE-0006120
ECHOBASE:
EB3782
OU-MICROARRAY:
b1840
PortEco:
yebZ
STRING:
511145.b1840
COLOMBOS: yebZ


Product      
Name: putative inner membrane protein
Synonym(s): YebZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.526
Isoelectric point: 11.433
Motif(s):
 
Type Positions Sequence
11 -> 31 FIHFTSLMLVFGFAMYGAWLA
50 -> 70 AAVWSLISATAMLAVQGGLMG
185 -> 284 QALMRFSWCGHFAVIGVLASGVLNALLITGFPPTLTTYWGQLLLLKAILVMIMVVIALANRYVLVPRMRQDEDRAAPWFVWMTKLEWAIGAVVLVIISLL
223 -> 243 WGQLLLLKAILVMIMVVIALA
118 -> 138 LLFMLTTAQFILLAGVGHATL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006825 - copper ion transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7013-MONOMER
ECOLIWIKI:
b1840
INTERPRO:
IPR008457
INTERPRO:
IPR032694
PANTHER:
PTHR34820
PFAM:
PF05425
PRIDE:
P76278
REFSEQ:
NP_416354
SMR:
P76278
UNIPROT:
P76278


Operon      
Name: yobA-yebZY         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB