RegulonDB RegulonDB 10.6.3: Gene Form
   

znuC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ruvB znuA znuB znuC Zur OxyR znuAp znuAp znuCp znuCp yebAp5 yebAp5 yebAp6 yebAp6 yebAp1 yebAp1

Gene      
Name: znuC    Texpresso search in the literature
Synonym(s): ECK1859, G7018, b1858, yebM
Genome position(nucleotides): 1942662 --> 1943417 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.21
External database links:  
ASAP:
ABE-0006198
ECHOBASE:
EB2931
ECOCYC:
G7018
ECOLIHUB:
znuC
OU-MICROARRAY:
b1858
REGULONDB:
b1858
STRING:
511145.b1858
M3D: znuC
COLOMBOS: znuC
PortEco: b1858


Product      
Name: Zn2+ ABC transporter ATP binding subunit
Synonym(s): YebM, ZnuC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.867
Isoelectric point: 9.794
Motif(s):
 
Type Positions Sequence
80 -> 83 TTLP
121 -> 124 LSGG
174 -> 176 VLM
135 -> 135 L
20 -> 149 LSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVTPDEGVIKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTHKEDILPALKRVQAGHLINAPMQKLSGGETQRVLLARALLNRPQLLVLDEPTQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.12 - heme, porphyrine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015633 - zinc-transporting ATPase activity
biological_process GO:0006811 - ion transport
GO:0006829 - zinc ion transport
GO:0010043 - response to zinc ion
GO:0071577 - zinc ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48234N
ECOCYC:
ZNUC-MONOMER
ECOLIWIKI:
b1858
INTERPRO:
IPR017882
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P0A9X1
PANTHER:
PTHR24220:SF189
PFAM:
PF00005
PRIDE:
P0A9X1
PRODB:
PRO_000024254
PROSITE:
PS51298
PROSITE:
PS50893
PROTEINMODELPORTAL:
P0A9X1
REFSEQ:
NP_416372
SMART:
SM00382
SMR:
P0A9X1
UNIPROT:
P0A9X1


Operon      
Name: znuCB         
Operon arrangement:
Transcription unit        Promoter
znuCB


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: Zur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebAp1 1941683 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebAp6 1941721 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebAp5 1941833 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB