RegulonDB RegulonDB 10.8: Gene Form
   

yecN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yecE cmoA yecN yecD cmoB

Gene      
Name: yecN    Texpresso search in the literature
Synonym(s): ECK1870, G7019, b1869
Genome position(nucleotides): 1952266 --> 1952661 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.76
External database links:  
ASAP:
ABE-0006235
ECHOBASE:
EB3786
OU-MICROARRAY:
b1869
PortEco:
yecN
STRING:
511145.b1869
COLOMBOS: yecN


Product      
Name: MAPEG family inner membrane protein YecN
Synonym(s): YecN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.226
Isoelectric point: 9.443
Motif(s):
 
Type Positions Sequence
3 -> 120 SALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVLMLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLW
108 -> 128 WCALLLMVLANLWYMPWELVF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7019-MONOMER
ECOLIWIKI:
b1869
INTERPRO:
IPR023352
INTERPRO:
IPR001129
PFAM:
PF01124
PRIDE:
P64515
REFSEQ:
NP_416383
SMR:
P64515
UNIPROT:
P64515


Operon      
Name: yecN-cmoAB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB