RegulonDB RegulonDB 10.8: Gene Form
   

cmoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torZ cmoB cmoA yecN

Gene      
Name: cmoA    Texpresso search in the literature
Synonym(s): ECK1871, G7020, b1870, yecO
Genome position(nucleotides): 1952702 --> 1953445 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.67
External database links:  
ASAP:
ABE-0006237
ECHOBASE:
EB3787
OU-MICROARRAY:
b1870
PortEco:
cmoA
STRING:
511145.b1870
COLOMBOS: cmoA


Product      
Name: carboxy-S-adenosyl-L-methionine synthase
Synonym(s): CmoA, YecO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.777
Isoelectric point: 5.334
Motif(s):
 
Type Positions Sequence
89 -> 89 D
60 -> 158 VYDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRRHIDAYKAPTPVDVIEGDIRDIAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGG
117 -> 118 DI
64 -> 66 GCS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016743 - carboxyl- or carbamoyltransferase activity
GO:0042803 - protein homodimerization activity
GO:1904047 - S-adenosyl-L-methionine binding
biological_process GO:0002098 - tRNA wobble uridine modification
External database links:  
ECOCYC:
G7020-MONOMER
ECOLIWIKI:
b1870
INTERPRO:
IPR005271
INTERPRO:
IPR041698
INTERPRO:
IPR029063
MINT:
P76290
MODBASE:
P76290
PANTHER:
PTHR43861:SF2
PDB:
4GEK
PDB:
4IWN
PFAM:
PF13649
PRIDE:
P76290
PRODB:
PRO_000022302
REFSEQ:
NP_416384
SMR:
P76290
SWISSMODEL:
P76290
UNIPROT:
P76290


Operon      
Name: yecN-cmoAB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB