RegulonDB RegulonDB 10.8: Gene Form
   

cmoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torZ cmoB cmoA yecN

Gene      
Name: cmoB    Texpresso search in the literature
Synonym(s): ECK1872, G7021, b1871, yecP
Genome position(nucleotides): 1953442 --> 1954413 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.06
External database links:  
ASAP:
ABE-0006241
ECHOBASE:
EB3788
OU-MICROARRAY:
b1871
PortEco:
cmoB
STRING:
511145.b1871
COLOMBOS: cmoB


Product      
Name: tRNA U34 carboxymethyltransferase
Synonym(s): CmoB, YecP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.007
Isoelectric point: 6.59
Motif(s):
 
Type Positions Sequence
315 -> 315 R
152 -> 154 DPT
7 -> 322 FYSLIAKNHLSHWLETLPAQIANWQREQQHGLFKQWSNAVEFLPEIKPYRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPALKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVYFIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVTESLADFLDPHDPGKTVEGYPAPKRAVLIARK
91 -> 91 K
181 -> 182 IE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0016740 - transferase activity
GO:0042802 - identical protein binding
biological_process GO:0006400 - tRNA modification
GO:0008033 - tRNA processing
GO:0002098 - tRNA wobble uridine modification
External database links:  
ECOCYC:
G7021-MONOMER
ECOLIWIKI:
b1871
INTERPRO:
IPR029063
INTERPRO:
IPR027555
INTERPRO:
IPR010017
MODBASE:
P76291
PANTHER:
PTHR10108:SF1036
PDB:
4QNX
PDB:
4QNV
PDB:
4QNU
PFAM:
PF08003
PRIDE:
P76291
PRODB:
PRO_000022303
REFSEQ:
NP_416385
SMR:
P76291
UNIPROT:
P76291


Operon      
Name: yecN-cmoAB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB