RegulonDB RegulonDB 10.8: Gene Form
   

torZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torZ torY cmoB cmoA

Gene      
Name: torZ    Texpresso search in the literature
Synonym(s): ECK1873, G7022, b1872, bisZ
Genome position(nucleotides): 1954578 <-- 1957007 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
Reference(s): [1] Gon S., et al., 2000
External database links:  
ASAP:
ABE-0006244
ECHOBASE:
EB3061
OU-MICROARRAY:
b1872
PortEco:
torZ
STRING:
511145.b1872
COLOMBOS: torZ


Product      
Name: trimethylamine N-oxide reductase 2
Synonym(s): BisZ, TorZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 88.964
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
299 -> 304 YTTGYP
670 -> 779 LQLLTAHPAHRLHSQLNYAELRKKYAIADREPITIHTEDAARFGIANGDLVRVWNKRGQILTGAVVTDGIKKGVVCVHEGAWPDLENGLCKNGSANVLTADIPSSQLANA
801 -> 803 AFD
84 -> 550 RIQHPMVRKSYLDNPLQPAKGRGEDTYVQVSWEQALKLIHEQHDRIRKANGPSAIFAGSYGWRSSGVLHKAQTLLQRYMNLAGGYSGHSGDYSTGAAQVIMPHVVGSVEVYEQQTSWPLILENSQVVVLWGMNPLNTLKIAWSSTDEQGLEYFHQLKKSGKPVIAIDPIRSETIEFFDDNATWIAPNMGTDVALMLGIAHTLMTQGKHDKVFLEKYTTGYPQFEEYLTGKSDNTPKSAVWAAEITGVPEAQIVKLAELMAANRTMLMAGWGIQRQQYGEQKHWMLVTLAAMLGQIGTPGGGFGFSYHYSNGGNPTRVGGVLPEMSAAIAGHASEAADDGGMTAIPVARIVDALENPGGKYQHNGKEQTYPNIKMIWWAGGGNFTHHQDTNRLIKAWQKPEMIVVSECYWTAAAKHADIVLPITTSFERNDLTMTGDYSNQHIVPMKQAVAPQFEARNDFDVFADLAE
76 -> 76 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0050626 - trimethylamine-N-oxide reductase (cytochrome c) activity
GO:0030151 - molybdenum ion binding
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9226N
ECOCYC:
G7022-MONOMER
ECOLIWIKI:
b1872
INTERPRO:
IPR041954
INTERPRO:
IPR041460
INTERPRO:
IPR019546
INTERPRO:
IPR009010
INTERPRO:
IPR006658
INTERPRO:
IPR006657
INTERPRO:
IPR006656
INTERPRO:
IPR006655
INTERPRO:
IPR006311
MODBASE:
P46923
PFAM:
PF18364
PFAM:
PF00384
PFAM:
PF01568
PRIDE:
P46923
PRODB:
PRO_000024093
PROSITE:
PS51318
PROSITE:
PS00490
PROSITE:
PS00932
REFSEQ:
NP_416386
SMR:
P46923
SWISSMODEL:
P46923
UNIPROT:
P46923


Operon      
Name: torYZ         
Operon arrangement:
Transcription unit        Promoter
torYZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gon S., Patte JC., Mejean V., Iobbi-Nivol C., 2000, The torYZ (yecK bisZ) operon encodes a third respiratory trimethylamine N-oxide reductase in Escherichia coli., J Bacteriol 182(20):5779-86


RegulonDB