RegulonDB RegulonDB 10.8: Gene Form
   

torY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torZ torY micL

Gene      
Name: torY    Texpresso search in the literature
Synonym(s): ECK1874, G7023, b1873, yecK
Genome position(nucleotides): 1957032 <-- 1958132 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.41
Reference(s): [1] Gon S., et al., 2000
External database links:  
ASAP:
ABE-0006246
ECHOBASE:
EB3062
OU-MICROARRAY:
b1873
PortEco:
torY
STRING:
511145.b1873
COLOMBOS: torY


Product      
Name: cytochrome c quinol dehydrogenase TorY
Synonym(s): TorY, YecK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,periplasmic space,inner membrane
Molecular weight: 40.286
Isoelectric point: 6.224
Motif(s):
 
Type Positions Sequence
6 -> 174 RIGLLFLLIAVVVGGGGLLLAQKVLHKTSDTAFCLSCHSMSKPFEEYQGTVHFSNQKGIRAECADCHIPKSGMDYLFAKLKASKDIYHEFVSGKIDSDDKFEAHRQEMAETVWKELKATDSATCRSCHSFDAMDIASQSESAQKMHNKAQKDSETCIDCHKGIAHFPPE
7 -> 27 IGLLFLLIAVVVGGGGLLLAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009276 - Gram-negative-bacterium-type cell wall
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0020037 - heme binding
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11829N
ECOCYC:
G7023-MONOMER
ECOLIWIKI:
b1873
INTERPRO:
IPR005126
INTERPRO:
IPR038266
INTERPRO:
IPR009154
INTERPRO:
IPR011031
INTERPRO:
IPR036280
MODBASE:
P52005
PFAM:
PF03264
PRIDE:
P52005
PRODB:
PRO_000024092
PROSITE:
PS51008
REFSEQ:
NP_416387
SMR:
P52005
UNIPROT:
P52005


Operon      
Name: torYZ         
Operon arrangement:
Transcription unit        Promoter
torYZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gon S., Patte JC., Mejean V., Iobbi-Nivol C., 2000, The torYZ (yecK bisZ) operon encodes a third respiratory trimethylamine N-oxide reductase in Escherichia coli., J Bacteriol 182(20):5779-86


RegulonDB