RegulonDB RegulonDB 10.8: Gene Form
   

cutC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torY cutC yecM micL cutCp2 cutCp2 micLp2 micLp2 micLp micLp TSS_2221 TSS_2221

Gene      
Name: cutC    Texpresso search in the literature
Synonym(s): ECK1875, G7024, b1874
Genome position(nucleotides): 1958520 <-- 1959266 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.94
External database links:  
ASAP:
ABE-0006252
ECHOBASE:
EB2790
OU-MICROARRAY:
b1874
PortEco:
cutC
STRING:
511145.b1874
COLOMBOS: cutC


Shine dalgarno      
Sequence: aggagtaaaaATGGCAttactggaaatttgctgttacagcatggaatgtgcactaacggcgcagcaaaacggcgcagacagagttgaattatgcgcagccccaaaagaggggggcttaacgccgtcgttgggtgtactgaaatccgtgcgccagcgggtgacgatccctgtgcatccgataattcgcccacgcggtggtgatttttgctacagcgacggtgagtttgccgccattcttgaggatgtgcgcacggtccgcgaattaggttttcctggactggtgacgggcgttctcgatgttgacGGG


Product      
Name: protein CutC
Synonym(s): CutC, protein potentially involved in copper homeostasis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.762
Isoelectric point: 5.842
Motif(s):
 
Type Positions Sequence
3 -> 200 LLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAG
18 -> 18 Q

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005507 - copper ion binding
biological_process GO:0006878 - cellular copper ion homeostasis
GO:0055070 - copper ion homeostasis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7024-MONOMER
ECOLIWIKI:
b1874
INTERPRO:
IPR023648
INTERPRO:
IPR036822
INTERPRO:
IPR005627
MODBASE:
P67826
PANTHER:
PTHR12598
PFAM:
PF03932
PRIDE:
P67826
REFSEQ:
YP_025309
SMR:
P67826
SWISSMODEL:
P67826
UNIPROT:
P67826


Operon      
Name: yecM-cutC         
Operon arrangement:
Transcription unit        Promoter
yecM-cutC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2221 1958648 reverse nd [RS-EPT-CBR] [1]
  promoter cutCp2 1959267 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB