RegulonDB RegulonDB 10.8: Gene Form
   

yecT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yecT flhE yecV RcsB-BglJ terminator yecTp yecTp yecTp3 yecTp3

Gene      
Name: yecT    Texpresso search in the literature
Synonym(s): ECK1878, G7026, b1877
Genome position(nucleotides): 1961972 --> 1962460 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.85
External database links:  
ASAP:
ABE-0006268
ECHOBASE:
EB4063
OU-MICROARRAY:
b1877
PortEco:
yecT
STRING:
511145.b1877
COLOMBOS: yecT


Product      
Name: protein YecT
Synonym(s): YecT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.885
Isoelectric point: 4.457
Motif(s):
 
Type Positions Sequence
35 -> 145 CWQKNSDDDTDVNVIKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLSDPYSESEWLSCMIIQTNTRTRQL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Gagarinova A., et al., 2016
External database links:  
ECOCYC:
G7026-MONOMER
ECOLIWIKI:
b1877
INTERPRO:
IPR009739
PFAM:
PF07007
PRIDE:
P76296
REFSEQ:
NP_416391
SMR:
P76296
UNIPROT:
P76296


Operon      
Name: yecT         
Operon arrangement:
Transcription unit        Promoter
yecT


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB-BglJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yecTp3 1961931 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gagarinova A., Stewart G., Samanfar B., Phanse S., White CA., Aoki H., Deineko V., Beloglazova N., Yakunin AF., Golshani A., Brown ED., Babu M., Emili A., 2016, Systematic Genetic Screens Reveal the Dynamic Global Functional Organization of the Bacterial Translation Machinery., Cell Rep 17(3):904-916

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB