RegulonDB RegulonDB 10.6.3: Gene Form
   

yecT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argS yecT flhE RcsB terminator yecTp yecTp yecTp3 yecTp3 TSS_2224 TSS_2224

Gene      
Name: yecT    Texpresso search in the literature
Synonym(s): ECK1878, G7026, b1877
Genome position(nucleotides): 1961972 --> 1962460 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.85
External database links:  
ASAP:
ABE-0006268
ECHOBASE:
EB4063
ECOCYC:
G7026
ECOLIHUB:
yecT
OU-MICROARRAY:
b1877
REGULONDB:
b1877
STRING:
511145.b1877
M3D: yecT
COLOMBOS: yecT
PortEco: b1877


Product      
Name: protein YecT
Synonym(s): YecT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.885
Isoelectric point: 4.457
Motif(s):
 
Type Positions Sequence
35 -> 145 CWQKNSDDDTDVNVIKSCLRQEYNLVDAQLNKAYGEAYRYIEQVPRTGVKKPDTEQLNLLKKSQRAWLDFRDKECELILSNEDVQDLSDPYSESEWLSCMIIQTNTRTRQL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Gagarinova A., et al., 2016
External database links:  
ECOCYC:
G7026-MONOMER
ECOLIWIKI:
b1877
INTERPRO:
IPR009739
PFAM:
PF07007
PRIDE:
P76296
PROTEINMODELPORTAL:
P76296
REFSEQ:
NP_416391
SMR:
P76296
UNIPROT:
P76296


Operon      
Name: yecT         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2224 1961626 forward nd [RS-EPT-CBR] [2]
  promoter yecTp3 1961931 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gagarinova A., Stewart G., Samanfar B., Phanse S., White CA., Aoki H., Deineko V., Beloglazova N., Yakunin AF., Golshani A., Brown ED., Babu M., Emili A., 2016, Systematic Genetic Screens Reveal the Dynamic Global Functional Organization of the Bacterial Translation Machinery., Cell Rep 17(3):904-916

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB