RegulonDB RegulonDB 10.8: Gene Form
   

flhE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flhA flhB yecT flhE

Gene      
Name: flhE    Texpresso search in the literature
Synonym(s): ECK1879, G7027, b1878
Genome position(nucleotides): 1962580 <-- 1962972 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.67
External database links:  
ASAP:
ABE-0006270
ECHOBASE:
EB3769
OU-MICROARRAY:
b1878
PortEco:
flhE
STRING:
511145.b1878
COLOMBOS: flhE


Product      
Name: flagellar protein FlhE
Synonym(s): FlhE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cell projection
Molecular weight: 14.059
Isoelectric point: 10.584
Motif(s):
 
Type Positions Sequence
1 -> 16 MRTLLAILLFPLLVQA
28 -> 130 GITLNHRGESMSSAPLSTRQPASGLMTLVAWRYQLIGPTPSGLRVRLCSQSRCVELEGQSGTTVAFSGIAAAEPLRFIWEVPGGGRLIPPLKVQRNEVIVNYR
17 -> 130 AGEGMWQASSVGITLNHRGESMSSAPLSTRQPASGLMTLVAWRYQLIGPTPSGLRVRLCSQSRCVELEGQSGTTVAFSGIAAAEPLRFIWEVPGGGRLIPPLKVQRNEVIVNYR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0009288 - bacterial-type flagellum
biological_process GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
Evidence: [HIFSO] Human inference of function by sequence orthology
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Lee J., et al., 2012
External database links:  
ECOCYC:
G7027-MONOMER
ECOLIWIKI:
b1878
INTERPRO:
IPR009420
PFAM:
PF06366
PRIDE:
P76297
REFSEQ:
NP_416392
SMR:
P76297
UNIPROT:
P76297


Operon      
Name: flhBAE         
Operon arrangement:
Transcription unit        Promoter
flhBAE


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lee J., Harshey RM., 2012, Loss of FlhE in the flagellar Type III secretion system allows proton influx into Salmonella and Escherichia coli., Mol Microbiol 84(3):550-65


RegulonDB