RegulonDB RegulonDB 10.8: Gene Form
   

insB5 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB5 insB5 uspC flhD insA5 OmpR LrhA IHF CRP AcrR YjjQ RcsAB FliZ OmpR Fur terminator uspCp4 uspCp4 uspCp5 uspCp5 uspCp6 uspCp6 uspCp2 uspCp2 uspCp9 uspCp9 uspCp8 uspCp8 TSS_2233 TSS_2233 insA-5p insA-5p TSS_2232 TSS_2232 flhDp2 flhDp2 flhDp flhDp flhCp3 flhCp3

Gene      
Name: insB5    Texpresso search in the literature
Synonym(s): ECK0022, G7029, b1893
Genome position(nucleotides): 1978518 <-- 1979021 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.56
External database links:  
ASAP:
ABE-0006308
ECOO157CYC:
Z1123
ECOO157CYC:
Z1632
ECOO157CYC:
Z1562
ECOO157CYC:
Z5491
ECOO157CYC:
Z1192
OU-MICROARRAY:
b1893
PortEco:
insB-5
COLOMBOS: insB5


Product      
Name: IS1 protein InsB
Synonym(s): InsB5
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.565
Isoelectric point: 10.657
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4445
INTERPRO:
IPR005063
PFAM:
PF03400
PRIDE:
P0CF28
REFSEQ:
NP_416407
UNIPROT:
P0CF28


Operon      
Name: insAB5A5B5         
Operon arrangement:
Transcription unit        Promoter
insA5B5AB5


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter flhCp3 1977932 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2232 1979050 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2233 1979233 reverse nd [RS-EPT-CBR] [2]
  promoter uspCp8 1979586 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter uspCp9 1979591 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter uspCp2 1979598 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter uspCp6 1979619 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter uspCp5 1979658 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter uspCp4 1979668 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB