RegulonDB RegulonDB 10.7: Gene Form
   

ftnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araF ftnB unknown yecJ CpxR AraC AraC AraC AraC CRP TSS_2238 TSS_2238 TSS_2237 TSS_2237 ftnBp2 ftnBp2 TSS_2236 TSS_2236 ftnBp ftnBp araFp araFp araFp2 araFp2

Gene      
Name: ftnB    Texpresso search in the literature
Synonym(s): ECK1900, G7033, b1902, yecI
Genome position(nucleotides): 1986925 --> 1987428 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.82
External database links:  
ASAP:
ABE-0006333
ECHOBASE:
EB2967
OU-MICROARRAY:
b1902
PORTECO:
ftnB
REGULONDB:
b1902
STRING:
511145.b1902
M3D: ftnB
COLOMBOS: ftnB
PortEco: b1902


Product      
Name: putative ferritin-like protein
Synonym(s): FtnB, YecI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.894
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
133 -> 167 LLQTILDEVRSAKLAGMCPVQTDQHVLNVVSHQLH
9 -> 142 KLNSQMNREFYASNLYLHLSNWCSEQSLNGTATFLRAQAQSNVTQMMRMFNFMKSVGATPIVKAIDVPGEKLNSLEELFQKTMEEYEQRSSTLAQLADEAKELNDDSTVNFLRDLEKEQQHDGLLLQTILDEVR
128 -> 128 Q
1 -> 145 MATAGMLLKLNSQMNREFYASNLYLHLSNWCSEQSLNGTATFLRAQAQSNVTQMMRMFNFMKSVGATPIVKAIDVPGEKLNSLEELFQKTMEEYEQRSSTLAQLADEAKELNDDSTVNFLRDLEKEQQHDGLLLQTILDEVRSAK
117 -> 117 V

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0004322 - ferroxidase activity
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
GO:0008199 - ferric iron binding
GO:0042802 - identical protein binding
biological_process GO:0006826 - iron ion transport
GO:0006879 - cellular iron ion homeostasis
GO:0055114 - oxidation-reduction process
GO:0006880 - intracellular sequestering of iron ion
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7033-MONOMER
ECOLIWIKI:
b1902
INTERPRO:
IPR001519
INTERPRO:
IPR041719
INTERPRO:
IPR012347
INTERPRO:
IPR008331
INTERPRO:
IPR009040
INTERPRO:
IPR009078
MODBASE:
P0A9A2
PANTHER:
PTHR11431
PFAM:
PF00210
PRIDE:
P0A9A2
PRODB:
PRO_000022713
PROSITE:
PS50905
PROTEINMODELPORTAL:
P0A9A2
REFSEQ:
NP_416415
SMR:
P0A9A2
UNIPROT:
P0A9A2


Operon      
Name: ftnB         
Operon arrangement:
Transcription unit        Promoter
ftnB
ftnB


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2236 1986797 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2237 1986863 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2238 1987007 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB