RegulonDB RegulonDB 10.7: Gene Form
   

yecR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftnA yecR isrB azuC H-NS H-NS H-NS Fur Fur Fur H-NS Fur Fur H-NS H-NS FlhDC FlhDC CRP CRP anti-anti-terminator anti-terminator terminator terminator TSS_2242 TSS_2242 ftnAp ftnAp yecRp yecRp TSS_2240 TSS_2240 azuCp azuCp

Gene      
Name: yecR    Texpresso search in the literature
Synonym(s): ECK1903, G7035, b1904
Genome position(nucleotides): 1988222 --> 1988545 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.31
External database links:  
ASAP:
ABE-0006338
ECHOBASE:
EB3790
OU-MICROARRAY:
b1904
PORTECO:
yecR
REGULONDB:
b1904
STRING:
511145.b1904
M3D: yecR
COLOMBOS: yecR
PortEco: b1904


Product      
Name: lipoprotein YecR
Synonym(s): YecR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.741
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
27 -> 98 VDAATGIVRLVYDQAFLQHAHTDRYVSRGIADRACQQEGYTHAVPFGQPVGNCSLFAGSLCLNTEFTLSYQC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G7035-MONOMER
ECOLIWIKI:
b1904
INTERPRO:
IPR025731
PFAM:
PF13992
PRIDE:
P76308
PROSITE:
PS51257
PROTEINMODELPORTAL:
P76308
REFSEQ:
NP_416417
UNIPROT:
P76308


Operon      
Name: yecR         
Operon arrangement:
Transcription unit        Promoter
yecR


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2240 1988002 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2242 1988699 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB