RegulonDB RegulonDB 10.7: Gene Form
   

tcyL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcyD tcyN tcyL sdsN yecCp3 yecCp3

Gene      
Name: tcyL    Texpresso search in the literature
Synonym(s): ECK1917, G7037, b1918, yecS
Genome position(nucleotides): 1997811 <-- 1998479 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.77
External database links:  
ASAP:
ABE-0006386
ECHOBASE:
EB3791
OU-MICROARRAY:
b1918
PORTECO:
yecS
REGULONDB:
b1918
STRING:
511145.b1918
M3D: tcyL
COLOMBOS: tcyL
PortEco: b1918


Product      
Name: cystine ABC transporter membrane subunit
Synonym(s): TcyL, YecS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.801
Isoelectric point: 9.648
Motif(s):
 
Type Positions Sequence
33 -> 214 GLLLGFILALMRLSPIWPVRWLARFYISIFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATVLSTLQNHFENQL
65 -> 85 TPLIAQLFMIYYGLPQFGIEL
183 -> 203 LEVFTMYLAASLIYWIMATVL
19 -> 207 AGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYISIFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATVLSTLQ
23 -> 43 LQLSIGGMFFGLLLGFILALM

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
GO:0033229 - cysteine transmembrane transporter activity
GO:0015184 - L-cystine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0006791 - sulfur utilization
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
GO:0015811 - L-cystine transport
GO:1903712 - cysteine transmembrane transport
GO:0015830 - diaminopimelate transport
Note(s): Note(s): ...[more].
Reference(s): [1] Deutch CE., et al., 2014
External database links:  
ECOCYC:
G7037-MONOMER
ECOLIWIKI:
b1918
INTERPRO:
IPR000515
INTERPRO:
IPR010065
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFT2
PROSITE:
PS50928
PROTEINMODELPORTAL:
P0AFT2
REFSEQ:
NP_416428
SMR:
P0AFT2
UNIPROT:
P0AFT2


Operon      
Name: dcyD-tcyLN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yecCp3 1997823 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Deutch CE., Spahija I., Wagner CE., 2014, Susceptibility of Escherichia coli to the toxic L-proline analogue L-selenaproline is dependent on two L-cystine transport systems., J Appl Microbiol 117(5):1487-99

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB