RegulonDB RegulonDB 10.7: Gene Form
   

tcyJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcyD tcyJ fliZ anti-anti-terminator anti-terminator terminator TSS_2257 TSS_2257 TSS_2256 (cluster) TSS_2256 (cluster) tcyJp tcyJp TSS_2254 TSS_2254 TSS_2253 TSS_2253 TSS_2252 TSS_2252 TSS_2251 TSS_2251 dcyDp dcyDp

Gene      
Name: tcyJ    Texpresso search in the literature
Synonym(s): ECK1919, G7039, b1920, fliY, ssi7, yzzR
Genome position(nucleotides): 1999585 <-- 2000385 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.81
External database links:  
ASAP:
ABE-0006392
ECHOBASE:
EB2545
OU-MICROARRAY:
b1920
PORTECO:
fliY
REGULONDB:
b1920
STRING:
511145.b1920
M3D: tcyJ
COLOMBOS: tcyJ
PortEco: b1920


Product      
Name: cystine ABC transporter periplasmic binding protein
Synonym(s): FliY, Ssi7, TcyJ, YzzR
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 29.039
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
1 -> 29 MKLAHLGRQALMGVMAVALVAGMSVKSFA
30 -> 266 DEGLLNKVKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVTK
44 -> 261 LVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016597 - amino acid binding
GO:0015276 - ligand-gated ion channel activity
GO:0015184 - L-cystine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0006791 - sulfur utilization
GO:0034220 - ion transmembrane transport
GO:0015811 - L-cystine transport
GO:0015830 - diaminopimelate transport
Note(s): Note(s): ...[more].
Reference(s): [1] Berger EA., et al., 1972
External database links:  
DIP:
DIP-47980N
ECOCYC:
G7039-MONOMER
ECOLIWIKI:
b1920
INTERPRO:
IPR001638
INTERPRO:
IPR018313
INTERPRO:
IPR001320
MINT:
MINT-1231539
MODBASE:
P0AEM9
PFAM:
PF00497
PRIDE:
P0AEM9
PRODB:
PRO_000022670
PROSITE:
PS01039
PROTEINMODELPORTAL:
P0AEM9
REFSEQ:
NP_416430
SMART:
SM00079
SMART:
SM00062
SMR:
P0AEM9
UNIPROT:
P0AEM9


Operon      
Name: fliAZ-tcyJ         
Operon arrangement:
Transcription unit        Promoter
tcyJ
fliAZY
fliAZY


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, H-NS, FlhDC
Repressed by: SutR, NsrR, MatA, IHF, CsgD


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2251 2000146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2252 2000154 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2253 2000191 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2254 2000398 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2256 (cluster) 2000468 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2257 2000470 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Berger EA., Heppel LA., 1972, A binding protein involved in the transport of cystine and diaminopimelic acid in Escherichia coli., J Biol Chem 247(23):7684-94

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB