RegulonDB RegulonDB 10.8: Gene Form
   

dgcQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcQ yedP yodC dsrA DksA-ppGpp DksA-ppGpp terminator dsrAp dsrAp

Gene      
Name: dgcQ    Texpresso search in the literature
Synonym(s): ECK1954, G7049, b1956, yedQ
Genome position(nucleotides): 2026323 <-- 2028017 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ASAP:
ABE-0006495
ECHOBASE:
EB3794
OU-MICROARRAY:
b1956
PortEco:
yedQ
STRING:
511145.b1956
COLOMBOS: dgcQ


Product      
Name: putative diguanylate cyclase DgcQ
Synonym(s): DgcQ, YedQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 64.283
Isoelectric point: 7.22
Motif(s):
 
Type Positions Sequence
41 -> 227 TWREVVVLEDAYISSQRNHLENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRDAVTEFEQHRDEHAWKIELNRRRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRAGFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQ
428 -> 563 HPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDN
398 -> 557 AWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNR
20 -> 40 LGPGHVVNLCFIVVLLFSTLL
360 -> 380 IALTLLWALFTTMLLISWYVI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0030244 - cellulose biosynthetic process
GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Boehm A., et al., 2010
External database links:  
ECOCYC:
G7049-MONOMER
ECOLIWIKI:
b1956
INTERPRO:
IPR029787
INTERPRO:
IPR033416
INTERPRO:
IPR000160
PFAM:
PF17151
PFAM:
PF00990
PRIDE:
P76330
PROSITE:
PS50887
REFSEQ:
NP_416465
SMART:
SM00267
SMR:
P76330
UNIPROT:
P76330


Operon      
Name: dgcQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Boehm A., Kaiser M., Li H., Spangler C., Kasper CA., Ackermann M., Kaever V., Sourjik V., Roth V., Jenal U., 2010, Second messenger-mediated adjustment of bacterial swimming velocity., Cell 141(1):107-16


RegulonDB