RegulonDB RegulonDB 10.8: Gene Form
   

yodB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zinT yodB serU terminator yodBp13 yodBp13 yodBp16 yodBp16 yodBp14 yodBp14 yodBp15 yodBp15

Gene      
Name: yodB    Texpresso search in the literature
Synonym(s): ECK1970, G7062, b1974
Genome position(nucleotides): 2042368 --> 2042898 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.18
External database links:  
ASAP:
ABE-0006552
ECHOBASE:
EB3803
OU-MICROARRAY:
b1974
PortEco:
yodB
STRING:
511145.b1974
COLOMBOS: yodB


Product      
Name: putative cytochrome b561 YodB
Synonym(s): YodB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.337
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
8 -> 28 QIYLHWITLLFVAITYAAMEL
142 -> 162 ANIGYFLIAAHAGAALFHHYI
3 -> 173 RFSKTQIYLHWITLLFVAITYAAMELRGWFPKGSSTYLLMRETHYNAGIFVWVLMFSRLIIKHRYSDPSIVPPPPAWQMKAASLMHIMLYITFLALPLLGIALMAYSGKSWSFLGFNVSPFVTPNSEIKALIKNIHETWANIGYFLIAAHAGAALFHHYIQKDNTLLRMMP
86 -> 106 LMHIMLYITFLALPLLGIALM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0020037 - heme binding
biological_process GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G7062-MONOMER
ECOLIWIKI:
b1974
INTERPRO:
IPR011577
INTERPRO:
IPR016174
PFAM:
PF01292
PRIDE:
P76345
REFSEQ:
NP_416483
SMR:
P76345
UNIPROT:
P76345


Operon      
Name: yodB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yodBp15 2042176 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yodBp14 2042261 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yodBp16 2042294 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yodBp13 2042308 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB