RegulonDB RegulonDB 10.8: Gene Form
   

shiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeJ amn shiA yeeL PhoB TSS_2289 TSS_2289 amnp1 amnp1 TSS_2288 TSS_2288 shiAp shiAp shiAp11 shiAp11 TSS_2286 TSS_2286

Gene      
Name: shiA    Texpresso search in the literature
Synonym(s): ECK1976, G7067, b1981, yeeM
Genome position(nucleotides): 2053643 --> 2054959 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.42
External database links:  
ASAP:
ABE-0006572
ECHOBASE:
EB4148
OU-MICROARRAY:
b1981
PortEco:
shiA
STRING:
511145.b1981
COLOMBOS: shiA


Product      
Name: shikimate:H+ symporter
Synonym(s): ShiA, ShiA shikimate MFS transporter, YeeM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 47.817
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
168 -> 188 VGYGVGLLLSTGLVSLISMMT
255 -> 275 IIALRLCELLTMYIVTAFALN
273 -> 431 ALNYSTQNMGLPRELFLNIGLLVGGLSCLTIPCFAWLADRFGRRRVYITGTLIGTLSAFPFFMALEAQSIFWIVFFSIMLANIAHDMVVCVQQPMFTEMFGASYRYSGAGVGYQVASVVGGGFTPFIAAALITYFAGNWHSVAIYLLAGCLISAMTALL
387 -> 407 VASVVGGGFTPFIAAALITYF
64 -> 84 LAAFATFGVGFLFRPLGGVIF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.20 - chorismate
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0022857 - transmembrane transporter activity
GO:0015530 - shikimate transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0015733 - shikimate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
SHIA-MONOMER
ECOLIWIKI:
b1981
INTERPRO:
IPR011701
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR005829
INTERPRO:
IPR005828
INTERPRO:
IPR004736
MODBASE:
P76350
PFAM:
PF00083
PFAM:
PF07690
PRIDE:
P76350
PRODB:
PRO_000023947
PROSITE:
PS00217
PROSITE:
PS50850
REFSEQ:
NP_416488
SMR:
P76350
UNIPROT:
P76350


Operon      
Name: shiA         
Operon arrangement:
Transcription unit        Promoter
shiA


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2286 2051392 reverse nd [RS-EPT-CBR] [1]
  promoter shiAp11 2053534 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2288 2054169 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2289 2055032 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB