RegulonDB RegulonDB 10.8: Gene Form
   

nac gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cbl nac asnV NtrC Nac TSS_2300 TSS_2300 asnVp asnVp nacp nacp cblp cblp

Gene      
Name: nac    Texpresso search in the literature
Synonym(s): ECK1983, G7072, b1988
Genome position(nucleotides): 2061016 <-- 2061933 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0006594
ECHOBASE:
EB4013
OU-MICROARRAY:
b1988
PortEco:
nac
STRING:
511145.b1988
COLOMBOS: nac


Product      
Name: DNA-binding transcriptional dual regulator Nac
Synonym(s): Nac
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 32.835
Isoelectric point: 7.6
Motif(s):
 
Type Positions Sequence
18 -> 37 LTQAAEVLHIAQPALSQQVA
1 -> 58 MNFRRLKYFVKIVDIGSLTQAAEVLHIAQPALSQQVATLEGELNQQLLIRTKRGVTPT
3 -> 62 FRRLKYFVKIVDIGSLTQAAEVLHIAQPALSQQVATLEGELNQQLLIRTKRGVTPTDAGK
87 -> 289 QALSGQVSIGFAPGTAASSITMPLLQAVRAEFPEIVIYLHENSGAVLNEKLINHQLDMAVIYEHSPVAGVSSQALLKEDLFLVGTQDCPGQSVDVNAIAQMNLFLPSDYSAIRLRVDEAFSLRRLTAKVIGEIESIATLTAAIASGMGVAVLPESAARSLCGAVNGWMSRITTPSMSLSLSLNLPARANLSPQAQAVKELLMS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0042128 - nitrate assimilation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IDA] Inferred from direct assay
[IFC] Inferred by functional complementation
Reference(s): [1] Muse WB., et al., 1998
[2] Zimmer DP., et al., 2000
External database links:  
ECOCYC:
G7072-MONOMER
ECOLIWIKI:
b1988
INTERPRO:
IPR036388
INTERPRO:
IPR005119
INTERPRO:
IPR036390
INTERPRO:
IPR000847
MODBASE:
Q47005
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
Q47005
PRINTS:
PR00039
PRODB:
PRO_000023331
PROSITE:
PS50931
REFSEQ:
NP_416493
SMR:
Q47005
UNIPROT:
Q47005


Operon      
Name: nac         
Operon arrangement:
Transcription unit        Promoter
nac


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC
Repressed by: Nac, Fur, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2300 2062260 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Muse WB., Bender RA., 1998, The nac (nitrogen assimilation control) gene from Escherichia coli., J Bacteriol 180(5):1166-73

 [2] Zimmer DP., Soupene E., Lee HL., Wendisch VF., Khodursky AB., Peter BJ., Bender RA., Kustu S., 2000, Nitrogen regulatory protein C-controlled genes of Escherichia coli: scavenging as a defense against nitrogen limitation., Proc Natl Acad Sci U S A 97(26):14674-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB