RegulonDB RegulonDB 10.8: Gene Form
   

yeeY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeY yeeZ yoeI plaP terminator yeeFp2 yeeFp2

Gene      
Name: yeeY    Texpresso search in the literature
Synonym(s): ECK2009, G7088, b2015
Genome position(nucleotides): 2087329 <-- 2088258 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.43
External database links:  
ASAP:
ABE-0006700
ECHOBASE:
EB3173
OU-MICROARRAY:
b2015
PortEco:
yeeY
STRING:
511145.b2015
COLOMBOS: yeeY


Product      
Name: putative DNA-binding transcriptional regulator YeeY
Synonym(s): YeeY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.169
Isoelectric point: 6.059
Motif(s):
 
Type Positions Sequence
20 -> 39 FAAASAKLYKTPSALSYTVH
1 -> 60 MKPLLDVLMILDALEKEGSFAAASAKLYKTPSALSYTVHKLESDLNIQLLDRSGHRAKFT
7 -> 63 VLMILDALEKEGSFAAASAKLYKTPSALSYTVHKLESDLNIQLLDRSGHRAKFTRTG
89 -> 290 EGWENELVIGVDDTFPFSLLAPLIEAFYQHHSVTRLKFINGVLGGSWDALTQGRADIIVGAMHEPPSSSEFGFSRLGDLEQVFAVAPHHPLALEEEPLNRRIIKRYRAIVVGDTAQAGASTASQLLDEQEAITVFDFKTKLELQISGLGCGYLPRYLAQRFLDSGALIEKKVVAQTLFEPVWIGWNEQTAGLASGWWRDEIL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G7088-MONOMER
ECOLIWIKI:
b2015
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P76369
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P76369
PROSITE:
PS50931
REFSEQ:
NP_416519
SMR:
P76369
UNIPROT:
P76369


Operon      
Name: yeeY         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeeFp2 2087238 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB