RegulonDB RegulonDB 10.8: Gene Form
   

yeeZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeY yeeZ yoeB yefM yeeZp5 yeeZp5 yeeZp7 yeeZp7 TSS_2324 TSS_2324 TSS_2323 TSS_2323

Gene      
Name: yeeZ    Texpresso search in the literature
Synonym(s): ECK2010, G7089, b2016
Genome position(nucleotides): 2088304 <-- 2089128 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.88
External database links:  
ASAP:
ABE-0006702
ECHOBASE:
EB3174
OU-MICROARRAY:
b2016
PortEco:
yeeZ
STRING:
511145.b2016
COLOMBOS: yeeZ


Product      
Name: putative epimerase YeeZ
Synonym(s): YeeZ, putative epimerase, with NAD(P)-binding Rossmann-fold domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.68
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
1 -> 24 MKKVAIVGLGWLGMPLAMSLSARG
170 -> 177 GRFFAGKT
25 -> 274 WQVTGSKTTQDGVEAARMSGIDSYLLRMEPELVCDSDDLDALMDADALVITLPARRSGPGDEFYLQAVQELVDSALAHRIPRIIFTSSTSVYGDAQGTVKETTPRNPVTNSGRVLEELEDWLHNLPGTSVDILRLAGLVGPGRHPGRFFAGKTAPDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNICAPAHPARNVFYPQMARLLGLEPPQFRNSLDSGKGKIIDGSRICNELGFEYQYPDPLVMPLE
10 -> 213 GWLGMPLAMSLSARGWQVTGSKTTQDGVEAARMSGIDSYLLRMEPELVCDSDDLDALMDADALVITLPARRSGPGDEFYLQAVQELVDSALAHRIPRIIFTSSTSVYGDAQGTVKETTPRNPVTNSGRVLEELEDWLHNLPGTSVDILRLAGLVGPGRHPGRFFAGKTAPDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNIC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0050662 - coenzyme binding
Note(s): Note(s): ...[more].
Reference(s): [1] Lynch SV., et al., 2007
External database links:  
DIP:
DIP-35847N
ECOCYC:
G7089-MONOMER
ECOLIWIKI:
b2016
INTERPRO:
IPR036291
INTERPRO:
IPR001509
MODBASE:
P0AD12
PFAM:
PF01370
PRIDE:
P0AD12
REFSEQ:
NP_416520
SMR:
P0AD12
UNIPROT:
P0AD12


Operon      
Name: yeeZ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2323 2089152 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2324 2089158 reverse nd [RS-EPT-CBR] [2]
  promoter yeeZp7 2089176 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yeeZp5 2089211 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lynch SV., Dixon L., Benoit MR., Brodie EL., Keyhan M., Hu P., Ackerley DF., Andersen GL., Matin A., 2007, Role of the rapA gene in controlling antibiotic resistance of Escherichia coli biofilms., Antimicrob Agents Chemother 51(10):3650-8

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB