RegulonDB RegulonDB 10.8: Gene Form
   

wzzB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ugd wzzB hisI hisF anti-anti-terminator anti-terminator terminator cldp10 cldp10 cldp7 cldp7 TSS_2367 TSS_2367 TSS_2366 TSS_2366 cldp6 cldp6 TSS_2365 TSS_2365 cldp9 cldp9 TSS_2364 TSS_2364 TSS_2363 TSS_2363

Gene      
Name: wzzB    Texpresso search in the literature
Synonym(s): ECK2022, G7090, b2027, cld, rol, wzz
Genome position(nucleotides): 2097321 <-- 2098301 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.87
External database links:  
ASAP:
ABE-0006731
ECHOBASE:
EB3182
OU-MICROARRAY:
b2027
PortEco:
cld
STRING:
511145.b2027
COLOMBOS: wzzB


Product      
Name: regulator of length of O-antigen component of lipopolysaccharide chains
Synonym(s): Cld, Rol, Wzz, WzzB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.455
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
296 -> 316 AITLILAVLLGGMVGAGIVLG
32 -> 52 MTIIISVIVAIALAIGYLAVA
16 -> 121 EQIDLIDLLVQLWRGKMTIIISVIVAIALAIGYLAVAKEKWTSTAIITQPDVGQIAGYNNAMNVIYGQAAPKVSDLQETLIGRFSSAFSALAETLDNQEEREKLTI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004713 - protein tyrosine kinase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0018108 - peptidyl-tyrosine phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7090-MONOMER
ECOLIWIKI:
b2027
INTERPRO:
IPR003856
PFAM:
PF02706
PRIDE:
P76372
PRODB:
PRO_000024226
REFSEQ:
NP_416531
SMR:
P76372
UNIPROT:
P76372


Operon      
Name: wzzB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2363 2096625 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2364 2096772 forward nd [RS-EPT-CBR] [1]
  promoter cldp9 2098310 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2365 2098331 reverse nd [RS-EPT-CBR] [1]
  promoter cldp6 2098375 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2366 2098377 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2367 2098390 forward nd [RS-EPT-CBR] [1]
  promoter cldp7 2098413 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter cldp10 2098475 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB