RegulonDB RegulonDB 10.8: Gene Form
   

ugd gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gnd ugd wzzB gndA anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator TSS_2372 (cluster) TSS_2372 (cluster) TSS_2371 TSS_2371 TSS_2370 TSS_2370 TSS_2369 TSS_2369 TSS_2368 TSS_2368 ugdp9 ugdp9 cldp10 cldp10 cldp7 cldp7 TSS_2367 TSS_2367 TSS_2366 TSS_2366 cldp6 cldp6 TSS_2365 TSS_2365 cldp9 cldp9

Gene      
Name: ugd    Texpresso search in the literature
Synonym(s): ECK2023, G7091, UDG8, b2028, pmrE, udg, yefA
Genome position(nucleotides): 2098447 <-- 2099613 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.79
External database links:  
ASAP:
ABE-0006734
ECHOBASE:
EB3183
OU-MICROARRAY:
b2028
PortEco:
ugd
STRING:
511145.b2028
COLOMBOS: ugd


Product      
Name: UDP-glucose 6-dehydrogenase
Synonym(s): PmrE, Udg, Ugd, YefA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.657
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
1 -> 169 MKITISGTGYVGLSNGLLIAQNHEVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDKIHFNATLDKNEAYRDADYVIIATPTDYDPKTNYFNTSSVESVIKDVVEINPYAVMVIKSTVPVGFTAAMHKKYRTENIIFSPEFLREGKALYDNLHPSRIVIGERSERAER
192 -> 281 EAEAIKLFANTYLAMRVAYFNELDSYAESLGLNSRQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYQSVPNNLISAIVDANR
2 -> 19 KITISGTGYVGLSNGLLI
301 -> 375 IYRLIMKSGSDNFRASSIQGIMKRIKAKGVEVIIYEPVMKEDSFFNSRLERDLATFKQQADVIISNRMAEELKDV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0003979 - UDP-glucose 6-dehydrogenase activity
GO:0051287 - NAD binding
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0006065 - UDP-glucuronate biosynthetic process
External database links:  
ECOCYC:
UGD-MONOMER
ECOLIWIKI:
b2028
INTERPRO:
IPR008927
INTERPRO:
IPR036291
INTERPRO:
IPR036220
INTERPRO:
IPR028357
INTERPRO:
IPR017476
INTERPRO:
IPR001732
INTERPRO:
IPR014026
INTERPRO:
IPR014027
MODBASE:
P76373
PANTHER:
PTHR11374
PFAM:
PF00984
PFAM:
PF03720
PFAM:
PF03721
PRIDE:
P76373
REFSEQ:
NP_416532
SMART:
SM00984
SMR:
P76373
SWISSMODEL:
P76373
UNIPROT:
P76373


Operon      
Name: ugd         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cldp9 2098310 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2365 2098331 reverse nd [RS-EPT-CBR] [2]
  promoter cldp6 2098375 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2366 2098377 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2367 2098390 forward nd [RS-EPT-CBR] [2]
  promoter cldp7 2098413 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cldp10 2098475 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ugdp9 2099735 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2368 2100229 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2369 2100231 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2370 2100277 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2371 2101069 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2372 (cluster) 2101178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB