RegulonDB RegulonDB 10.8: Gene Form
   

insH7 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wbbK insH7 gnd gndA wbbJ terminator TSS_2382 TSS_2382 TSS_2381 TSS_2381 insHp4 insHp4 insHp5 insHp5 insHp6 insHp6 TSS_2380 (cluster) TSS_2380 (cluster) TSS_2379 TSS_2379 TSS_2378 TSS_2378 TSS_2377 TSS_2377 TSS_2376 TSS_2376 gndp gndp TSS_2374 TSS_2374 TSS_2373 (cluster) TSS_2373 (cluster) TSS_2372 (cluster) TSS_2372 (cluster) TSS_2371 TSS_2371

Gene      
Name: insH7    Texpresso search in the literature
Synonym(s): ECK0261, G7092, b2030, trs5-7, yi52_7
Genome position(nucleotides): 2101895 <-- 2102875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0006742
OU-MICROARRAY:
b2030
PortEco:
insH-7
STRING:
511145.b3505
COLOMBOS: insH7


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH7
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4237
ECOLIWIKI:
b2030
INTERPRO:
IPR008490
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF05598
PRIDE:
P0CE54
REFSEQ:
NP_416535
SMR:
P0CE54
UNIPROT:
P0CE54


Operon      
Name: insH7         
Operon arrangement:
Transcription unit        Promoter
insH-7


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2371 2101069 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2372 (cluster) 2101178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2373 (cluster) 2101320 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2374 2101322 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2376 2101396 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2377 2101409 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2378 2101436 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2379 2102902 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2380 (cluster) 2102949 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter insHp6 2103049 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp5 2103090 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2103093 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2381 2103462 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2382 2103479 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB