RegulonDB RegulonDB 10.8: Gene Form
   

wzc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzc wcaA wzb terminator

Gene      
Name: wzc    Texpresso search in the literature
Synonym(s): ECK2054, G7105, b2060
Genome position(nucleotides): 2133490 <-- 2135652 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.66
External database links:  
ASAP:
ABE-0006819
ECHOBASE:
EB3338
OU-MICROARRAY:
b2060
PortEco:
wzc
STRING:
511145.b2060
COLOMBOS: wzc


Product      
Name: protein-tyrosine kinase Wzc
Synonym(s): Wzc
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 79.343
Isoelectric point: 6.898
Motif(s):
 
Type Positions Sequence
538 -> 653 IGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAA
540 -> 540 K
422 -> 422 P
491 -> 491 Y
637 -> 642 DLVLID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016887 - ATPase activity
GO:0016301 - kinase activity
GO:0004713 - protein tyrosine kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0016310 - phosphorylation
GO:0045226 - extracellular polysaccharide biosynthetic process
GO:0038083 - peptidyl-tyrosine autophosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Stevenson G., et al., 1996
External database links:  
DIP:
DIP-28075N
ECOCYC:
G7105-MONOMER
ECOLIWIKI:
b2060
INTERPRO:
IPR003856
INTERPRO:
IPR032807
INTERPRO:
IPR027417
INTERPRO:
IPR025669
INTERPRO:
IPR005702
MINT:
P76387
MODBASE:
P76387
PDB:
3LA6
PFAM:
PF02706
PFAM:
PF13807
PFAM:
PF13614
PRIDE:
P76387
PRODB:
PRO_000024223
REFSEQ:
NP_416564
SMR:
P76387
UNIPROT:
P76387


Operon      
Name: wza-wzb-wzc-wcaAB         
Operon arrangement:
Transcription unit        Promoter
wzbc
wza-wzb-wzc-wcaAB


Transcriptional Regulation      
Display Regulation             
Activated by: RcsAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Stevenson G., Andrianopoulos K., Hobbs M., Reeves PR., 1996, Organization of the Escherichia coli K-12 gene cluster responsible for production of the extracellular polysaccharide colanic acid., J Bacteriol 178(16):4885-93


RegulonDB