RegulonDB RegulonDB 10.8: Gene Form
   

yegJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegI pphC yegJ yegL yegIp7 yegIp7 yegIp9 yegIp9 yegJp8 yegJp8 yegJp7 yegJp7 yegIp8 yegIp8

Gene      
Name: yegJ    Texpresso search in the literature
Synonym(s): ECK2065, G7110, b2071
Genome position(nucleotides): 2151185 --> 2151646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.13
External database links:  
ASAP:
ABE-0006863
ECHOBASE:
EB3806
OU-MICROARRAY:
b2071
PortEco:
yegJ
STRING:
511145.b2071
COLOMBOS: yegJ


Product      
Name: DUF2314 domain-containing protein YegJ
Synonym(s): YegJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.428
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
33 -> 149 QAMSDAIKHARKETDKFIEVMNKKDADTFAVKAPITDHGRTEHFWLTDVTYSNGMFIGVISNDPGIVTNVEYGQEWKIKKEDISDWMYTRGDKIYGGYTIDPLLVTYPKEEADELRA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11880N
ECOCYC:
G7110-MONOMER
ECOLIWIKI:
b2071
INTERPRO:
IPR018756
PFAM:
PF10077
PRIDE:
P76394
REFSEQ:
NP_416575
UNIPROT:
P76394


Operon      
Name: yegJ         
Operon arrangement:
Transcription unit        Promoter
yegJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegIp8 2150999 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yegJp7 2151016 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yegJp8 2151051 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yegIp9 2151076 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yegIp7 2151077 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB