RegulonDB RegulonDB 10.8: Gene Form
   

pphC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphC yegL yegJ sibA ibsA SibA sibAp sibAp

Gene      
Name: pphC    Texpresso search in the literature
Synonym(s): ECK2066, G7111, b2072, yegK
Genome position(nucleotides): 2151711 <-- 2152472 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0006865
ECHOBASE:
EB3807
OU-MICROARRAY:
b2072
PortEco:
yegK
STRING:
511145.b2072
COLOMBOS: pphC


Product      
Name: protein-serine/threonine phosphatase PphC
Synonym(s): PphC, YegK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.208
Isoelectric point: 4.177
Motif(s):
 
Type Positions Sequence
11 -> 220 VGTSHISADLPCQDACQMQIAWLNDQQPLLSVFVADGAGSVSQGGEGAMLAVNEAMAYMSQKVQGGELGLNDVLATNMVLTIRQRLFAEAEAKELAVRDFACTFLGLISSPDGTLIMQIGDGGVVVDLGHGLQLPLTPMAGEYANMTHFITDEDAVSRLETFTSTGRAHKVAAFTDGIQRLALNMLDNSPHVPFFTPFFNGLAAATQEQL
46 -> 46 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0016791 - phosphatase activity
GO:0004722 - protein serine/threonine phosphatase activity
biological_process GO:0006470 - protein dephosphorylation
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Rajagopalan K., et al., 2018
External database links:  
ECOCYC:
G7111-MONOMER
ECOLIWIKI:
b2072
INTERPRO:
IPR036457
PFAM:
PF13672
PRIDE:
P76395
REFSEQ:
NP_416576
UNIPROT:
P76395


Operon      
Name: yegL-pphC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  srna SibA 2153349 2153408 reverse unknow. nd nd


Reference(s)    

 [1] Rajagopalan K., Dworkin J., 2018, Identification and biochemical characterization of a novel PP2C-like Ser/Thr phosphatase in E. coli., J Bacteriol


RegulonDB