RegulonDB RegulonDB 10.8: Gene Form
   

yegL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphC yegL yegJ sibA ibsA SibA sibAp sibAp

Gene      
Name: yegL    Texpresso search in the literature
Synonym(s): ECK2067, G7112, b2073
Genome position(nucleotides): 2152469 <-- 2153128 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.06
External database links:  
ASAP:
ABE-0006867
ECHOBASE:
EB3808
OU-MICROARRAY:
b2073
PortEco:
yegL
STRING:
511145.b2073
COLOMBOS: yegL


Product      
Name: IPR002035 domain-containing protein YegL
Synonym(s): YegL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.218
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
24 -> 173 LLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKRVELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGISYYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQIS
21 -> 199 PCILLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKRVELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGISYYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQISVRQPLPLQGLQFRELFSWLSSSLRSV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11882N
ECOCYC:
G7112-MONOMER
ECOLIWIKI:
b2073
INTERPRO:
IPR011392
INTERPRO:
IPR036465
INTERPRO:
IPR002035
MODBASE:
P76396
PFAM:
PF00092
PRIDE:
P76396
PROSITE:
PS50234
REFSEQ:
NP_416577
SMART:
SM00327
SMR:
P76396
UNIPROT:
P76396


Operon      
Name: yegL-pphC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  srna SibA 2153349 2153408 reverse unknow. nd nd



RegulonDB