RegulonDB RegulonDB 10.8: Gene Form
   

mdtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtB mdtC mdtA sibB ibsB BaeR CpxR CpxR SibB mdtAp mdtAp

Gene      
Name: mdtA    Texpresso search in the literature
Synonym(s): ECK2070, G7113, b2074, yegM
Genome position(nucleotides): 2154016 --> 2155263 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.29
External database links:  
ASAP:
ABE-0006872
ECHOBASE:
EB3809
OU-MICROARRAY:
b2074
PortEco:
mdtA
STRING:
511145.b2074
COLOMBOS: mdtA


Product      
Name: multidrug efflux pump membrane fusion protein MdtA
Synonym(s): MdtA, MdtA membrane fusion protein, YegM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 44.464
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
1 -> 21 MKGSYKSRWVIVIVVVIAAIA
22 -> 415 AFWFWQGRNDSRSAAPGATKQAQQSPAGGRRGMRSGPLAPVQAATAVEQAVPRYLTGLGTITAANTVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDPSQFKVALAQAQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIKADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQDDALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQKVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS
198 -> 301 ITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQDD
87 -> 135 TVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDPSQFKVALAQAQGQLA
6 -> 27 KSRWVIVIVVVIAAIAAFWFWQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0015562 - efflux transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0042908 - xenobiotic transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
MDTA
ECOLIWIKI:
b2074
INTERPRO:
IPR022824
INTERPRO:
IPR039562
INTERPRO:
IPR006143
MODBASE:
P76397
PANTHER:
PTHR30469:SF22
PFAM:
PF13533
PRIDE:
P76397
PRODB:
PRO_000023182
REFSEQ:
NP_416578
SMR:
P76397
UNIPROT:
P76397


Operon      
Name: mdtABCD-baeSR         
Operon arrangement:
Transcription unit        Promoter
mdtABCD-baeSR
baeSR


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR
Growth Conditions:

[1] 

C: Escherichia coli| plasmid pBAD/Myc-HisA mutant| LB medium| 37.0 C| mid exponential phase
E: Escherichia coli| plasmid pBADBaeR (arabinose-induced baeR) mutant| LB medium| 37.0 C| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  srna SibB 2153681 2153737 reverse unknow. nd nd


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB