RegulonDB RegulonDB 10.8: Gene Form
   

trhP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trhP yegP cyaR CRP cyaRp cyaRp yegQp1 yegQp1

Gene      
Name: trhP    Texpresso search in the literature
Synonym(s): ECK2077, G7118, b2081, yegQ
Genome position(nucleotides): 2165668 --> 2167029 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.11
External database links:  
ASAP:
ABE-0006891
ECHOBASE:
EB3813
OU-MICROARRAY:
b2081
PortEco:
yegQ
STRING:
511145.b2081
COLOMBOS: trhP


Product      
Name: tRNA wobble base hydroxylation protein TrhP
Synonym(s): TrhP, YegQ, putative peptidase YegQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.193
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
75 -> 343 LKTFIRDLKPVVEMGPDALIMSDPGLIMLVREHFPEMPIHLSVQANAVNWATVKFWQQMGLTRVILSRELSLEEIEEIRNQVPDMEIEIFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYNVQEGKEDDVGNIVHKYEPIPVQNVEPTLGIGAPTDKVFMIEEAQRPGEYMTAFEDEHGTYIMNSKDLRAIAHVERLTKMGVHSLKIEGRTKSFYYCARTAQVYRKAIDDAAAGKPFDTSLLETLEGLAHRGYTEGFLRRHT
359 -> 440 RQQFVGEFTGERKGDLAAVAVKNKFSVGDSLELMTPQGNINFTLEHMENAKGEAMPIAPGDGYTVWLPVPQDLELNYALLMR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0002098 - tRNA wobble uridine modification
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lauhon CT. 2019
[2] Sakai Y., et al., 2019
External database links:  
DIP:
DIP-11887N
ECOCYC:
G7118-MONOMER
ECOLIWIKI:
b2081
INTERPRO:
IPR001539
INTERPRO:
IPR032525
PFAM:
PF01136
PFAM:
PF16325
PRIDE:
P76403
PROSITE:
PS01276
REFSEQ:
NP_416585
SMR:
P76403
UNIPROT:
P76403


Operon      
Name: trhP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegQp1 2165591 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lauhon CT., 2019, Identification and characterization of genes required for 5-hydroxyuridine synthesis in Bacillus subtilis and Escherichia coli tRNA., J Bacteriol

 [2] Sakai Y., Kimura S., Suzuki T., 2019, Dual pathways of tRNA hydroxylation ensure efficient translation by expanding decoding capability., Nat Commun 10(1):2858

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB