RegulonDB RegulonDB 10.7: Gene Form
   

ogrK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegR unknown ogrK yegZ cyaR terminator ogrKp5 ogrKp5 cyaRp cyaRp

Gene      
Name: ogrK    Texpresso search in the literature
Synonym(s): ECK2079, G7119, b2082
Genome position(nucleotides): 2167302 <-- 2167520 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.68
External database links:  
ASAP:
ABE-0006893
ECHOBASE:
EB2324
OU-MICROARRAY:
b2082
PORTECO:
ogrK
REGULONDB:
b2082
STRING:
511145.b2082
M3D: ogrK
COLOMBOS: ogrK
PortEco: b2082


Product      
Name: prophage P2 late control protein OgrK
Synonym(s): OgrK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.43
Isoelectric point: 8.653
Motif(s):
 
Type Positions Sequence
57 -> 57 V
3 -> 49 HCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESVQRYI

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IFC] Inferred by functional complementation
Reference(s): [1] Maharjan RP., et al., 2013
[2] Perez-Rueda E., et al., 2004
[3] Slettan A., et al., 1992
External database links:  
ECOCYC:
G7119-MONOMER
ECOLIWIKI:
b2082
INTERPRO:
IPR007684
PFAM:
PF04606
PRIDE:
P37057
PRODB:
PRO_000023449
PROTEINMODELPORTAL:
P37057
REFSEQ:
NP_416586
UNIPROT:
P37057


Operon      
Name: ogrK         
Operon arrangement:
Transcription unit        Promoter
ogrK


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ogrKp5 2167548 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Maharjan RP., Gaffe J., Plucain J., Schliep M., Wang L., Feng L., Tenaillon O., Ferenci T., Schneider D., 2013, A case of adaptation through a mutation in a tandem duplication during experimental evolution in Escherichia coli., BMC Genomics 14:441

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Slettan A., Gebhardt K., Kristiansen E., Birkeland NK., Lindqvist BH., 1992, Escherichia coli K-12 and B contain functional bacteriophage P2 ogr genes., J Bacteriol 174(12):4094-100

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB