RegulonDB RegulonDB 10.7: Gene Form
   

insE-5 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF-5 gatD yegS insF-5 insE-5 TSS_2406 (cluster) TSS_2406 (cluster)

Gene      
Name: insE-5    Texpresso search in the literature
Synonym(s): ECK0298, G7125, b2088
Genome position(nucleotides): 2170236 --> 2170535 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0006917
OU-MICROARRAY:
b2088
PORTECO:
insE-5
REGULONDB:
b2088
STRING:
511145.b2088
M3D: insE-5
COLOMBOS: insE-5
PortEco: b2088


Product      
Name: IS3 element protein InsE
Synonym(s): InsE-5
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.543
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
DIP:
DIP-60621N
ECOCYC:
MONOMER0-4245
ECOLIWIKI:
b2088
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF70
PROTEINMODELPORTAL:
P0CF70
REFSEQ:
NP_416592
SMR:
P0CF70
UNIPROT:
P0CF70


Operon      
Name: insE-5EF-5F-5         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2406 (cluster) 2172607 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB