RegulonDB RegulonDB 10.7: Gene Form
   

yegV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegT yegU yegV yegX yegW

Gene      
Name: yegV    Texpresso search in the literature
Synonym(s): ECK2093, G7132, b2100
Genome position(nucleotides): 2181096 --> 2182061 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.94
External database links:  
ASAP:
ABE-0006950
ECHOBASE:
EB3818
OU-MICROARRAY:
b2100
PORTECO:
yegV
REGULONDB:
b2100
STRING:
511145.b2100
M3D: yegV
COLOMBOS: yegV
PortEco: b2100


Product      
Name: putative sugar kinase YegV
Synonym(s): YegV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.385
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
17 -> 306 QSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLISLIDNAEGDNGWCLALVEPDGERTFMSFSGVENQWNRQWLARLTVAPGSLLYFSGYQLASPCGELLVEWLEELQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAEIAAERFALSAEITTLGKQWQEKFAAPLIVRLDKEGAWYFSNDASGCIPAFPTQVVDTIGAGDSHAGGVLAGLASGLPLADAVLLGNAVASWVVGHRGGD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0019200 - carbohydrate kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
biological_process GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11892N
ECOCYC:
G7132-MONOMER
ECOLIWIKI:
b2100
INTERPRO:
IPR002173
INTERPRO:
IPR002139
INTERPRO:
IPR011611
INTERPRO:
IPR029056
MODBASE:
P76419
PFAM:
PF00294
PRIDE:
P76419
PRINTS:
PR00990
PROSITE:
PS00584
PROSITE:
PS00583
PROTEINMODELPORTAL:
P76419
REFSEQ:
NP_416603
SMR:
P76419
UNIPROT:
P76419


Operon      
Name: yegTUV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB