RegulonDB RegulonDB 10.7: Gene Form
   

yegW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegU yegV yegX yegW yegT

Gene      
Name: yegW    Texpresso search in the literature
Synonym(s): ECK2094, G7133, b2101
Genome position(nucleotides): 2182035 <-- 2182781 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.41
External database links:  
ASAP:
ABE-0006952
ECHOBASE:
EB3819
OU-MICROARRAY:
b2101
PORTECO:
yegW
REGULONDB:
b2101
STRING:
511145.b2101
M3D: yegW
COLOMBOS: yegW
PortEco: b2101


Product      
Name: putative DNA-binding transcriptional regulator YegW
Synonym(s): YegW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.277
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
22 -> 90 TPLYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQINNI
29 -> 87 AETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQI
50 -> 69 ERDLSQLTGVSRITVRKAMQ
108 -> 242 RGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEAVSIEESWVPAHLIHDVDAIGISLYDYFRSQHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQVALDQQQRPIEYSISHCRSDLY

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11893N
ECOCYC:
G7133-MONOMER
ECOLIWIKI:
b2101
INTERPRO:
IPR028978
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011663
INTERPRO:
IPR000524
MODBASE:
P0ACM5
PFAM:
PF07702
PFAM:
PF00392
PRIDE:
P0ACM5
PRINTS:
PR00035
PROSITE:
PS50949
PROTEINMODELPORTAL:
P0ACM5
REFSEQ:
NP_416604
SMART:
SM00866
SMART:
SM00345
SMR:
P0ACM5
SWISSMODEL:
P0ACM5
UNIPROT:
P0ACM5


Operon      
Name: yegW         
Operon arrangement:
Transcription unit        Promoter
yegW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB